You have no items in your shopping cart.
SARS MERS Protein
SKU: orb428303
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Protein Sequence | EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYHHHHHH |
| Purity | Protein is >95% pure as determined by 10% PAGE (coomassie staining). |
Storage & Handling
−| Storage | Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile filtered clear solution. |
| Buffer/Preservatives | SARS MERS protein solution is supplied in PBS, 25mM arginine and 0.05% sodium azide. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−EIDD-1931 [orb1298882]
99.18%
3258-02-4
259.22
C9H13N3O6
25 mg, 5 mg, 500 mg, 1 mg, 50 mg, 100 mg, 10 mgSARS MERS Protein [orb753191]
Greater than 85.0% as determined by SDS-PAGE.
Sf9, Baculovirus cells
1 mg, 2 μg, 10 μgSARS MERS RBD Protein [orb753194]
Greater than 90.0% as determined by SDS-PAGE.
Sf9, Baculovirus cells
1 mg, 10 μg, 2 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
SARS MERS Protein (orb428303)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review