[Ser8]-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat)

SKU: orb2694351

Description

(Ser8)-GLP-1 (7-36) amide, human is a glucagon-like peptide 1 amide derived from glucagonogen, a cleavage product of the GLP-1 (1-36) amide peptide. (Ser8)-GLP-1 (7-36) amide, human is an entero-insulinotropic hormone that causes glucose-dependent release of insulin from pancreatic β-cells and affects gastrointestinal motility and secretion.

Images & Validation

−

Key Properties

−

Target	GCCR
Molecular Weight	3313.7
Protein Sequence	HSEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Purity	≥95%

Storage & Handling

−

Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

GCCR

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols