Cart summary

You have no items in your shopping cart.

SFTPA2 Rabbit Polyclonal Antibody

SKU: orb326486

Description

Rabbit polyclonal antibody to SFTPA2

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetSFTPA2
Protein SequenceSynthetic peptide located within the following region: PGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQIL
Molecular Weight26kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti COLEC5 antibody, anti FLJ50594 antibody, anti FLJ50597 antibody, anti FLJ51953 antibody, anti FLJ79091 antibody, anti FLJ93678 antibody, anti MGC133169 antibody, anti MGC133366 antibody, anti MGC189714 antibody, anti MGC189761 antibody, anti PSAP antibody, anti SFTP1 antibody, anti SFTPA2B antibody, anti SPA2 antibody, anti SPAII antibody

Similar Products

  • SFTPA1/2 Rabbit Polyclonal Antibody [orb251573]

    IF,  IHC,  IHC-Fr,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • SP-A rabbit pAb Antibody [orb766796]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • SFTPA1 Rabbit Polyclonal Antibody [orb11402]

    IF,  IHC-Fr,  IHC-P

    Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • SFTPA1/2 Rabbit Polyclonal Antibody [orb215430]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
  • SFTPA2 Antibody [orb672023]

    ELISA,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SFTPA2 Rabbit Polyclonal Antibody

Lanes: 1: 20 ng human SP-A2 protein, 2: 20 ug rat wt BAL cell lysate, 3: 25 ng hSP-A2 (1A0) protein purified from transfected CHO lysate, 4: 25 ng hSP-A2 (1A1) protein purified from transfected CHO lysate, 5: 25 ng hSP-A1 (6A2) protein purified from transfected CHO lysate, 6: 25 ng hSP-A1 (6A4) protein purified from transfected CHO lysate, 7: 25 ng hSP-A2/1 (1A0/6A4) protein purified from transfected CHO lysate, 8: 25 ng hSP-A2/1 (1A1/6A2) protein purified from transfected CHO lysate, 9: 20 ug SP-A KO mouse BAL lysate, 10: 25 ng hSP-A2 (1A0) protein purified from transfected mouse BAL lysate, 11: 25 ng hSP-A2 (1A1) protein purified from transfected mouse BAL lysate, 12: 25 ng hSP-A1 (6A2) protein purified from transfected mouse BAL lysate, 13: 25 ng hSP-A1 (6A4) protein purified from transfected mouse BAL lysate, 14: 25 ng hSP-A2/1 (1A0/6A2) protein purified from transfected mouse BAL lysate, 15: 25 ng mouse SP-A2 protein purified from mouse BAL lysate, 16: 20 ug mouse wt BAL lysate, 17: 15 ug human wt T2 lysate, 18: 25 ng human SP-A2 protein.

SFTPA2 Rabbit Polyclonal Antibody

Lanes: Lane 1: 25 ng purified Human Alveolar sample (w/SP-A1+SP-A2), Lane 1: 25 ng purified Human Alveolar sample (w/SP-A1+SP-A2), Lane 2: 20 ug Rat bronchoalveolar lavage, Lane 3: 25 ng hSP-A2 variant expressed in CHO cells, Lane 4: 25 ng hSP-A2 variant expressed in CHO cells, Lane 5: 25 ng hSP-A1/A2 variants expressed in CHO cells, Lane 6: 25 ng hSP-A1/A2 variants expressed in CHO cells, Lane 7: 20 ug SP-A1/2 KO mouse bronchoalveolar lavage, Lane 8: 20 ug hSP-A2 variant transgenic mouse bronchoalveolar lavage, Lane 9: 20 ug hSP-A2 variant transgenic mouse bronchoalveolar lavage, Lane 10: 20 ug hSP-A1 variant transgenic mouse bronchoalveolar lavage, Lane 11: 20 ug hSP-A1 variant transgenic mouse bronchoalveolar lavage, Lane 12: 20 ug hSP-A1/A2 variants transgenic mouse bronchoalveolar lavage, Lane 13: 20 ug mSP-A1/A2 bronchoalveolar lavage; +/- mouse, Lane 14: 20 ug mSP-A1/A2 bronchoalveolar lavage; WT mouse, Lane 15: 10 ug human alveolar cell lysate, Lane 16: 25 ng purified hSP-A1/A2, Primary Antibody Dilution: 1:2500, Secondary Antibody: IgG HRP Conj, Secondary Antibody Dilution: 1:10000, Gene Name: SFTPA2.

SFTPA2 Rabbit Polyclonal Antibody

WB Suggested Anti-SFTPA2 Antibody, Titration: 1.0 ug/mL, Positive Control: Fetal Heart.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SFTPA2 Rabbit Polyclonal Antibody (orb326486)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry