Cart summary

You have no items in your shopping cart.

Sheep IL-6 protein

SKU: orb1216257

Description

The Ovine IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ovine IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Ovine IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Ovine IL-6 Specifications: (Molecular Weight: 20.4 kDa) (Amino Acid Sequence: GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK (179)) (Gene ID: 443406).

Images & Validation

Key Properties

SourceYeast
Biological OriginOvine
TargetIL-6
Molecular Weight20.4 kDa
Protein Length179.0
Protein SequenceGPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK (179)
Purity98%

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
DisclaimerFor research use only

Similar Products

  • Sheep IL6 protein [orb244306]

    Greater than 90% as determined by SDS-PAGE.

    47.5 kDa

    E.coli

    20 μg, 100 μg, 1 mg
  • Sheep IL6 protein [orb245888]

    Greater than 90% as determined by SDS-PAGE.

    22.5 kDa

    Yeast

    20 μg, 100 μg, 1 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Sheep IL-6 protein (orb1216257)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 300.00
25 μg
$ 540.00
100 μg
$ 1,340.00
500 μg
$ 4,260.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry