You have no items in your shopping cart.
Description
Research Area
Immunology & Inflammation
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Ovine |
| Target | IL-6 |
| Protein Length | 179.0 |
| MW | 20.4 kDa |
| Purity | 98% |
| Protein Sequence | GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK (179) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Sheep IL6 protein [orb245888]
Greater than 90% as determined by SDS-PAGE.
22.5 kDa
Yeast
100 μg, 20 μg, 1 mgSheep IL6 protein [orb244306]
Greater than 90% as determined by SDS-PAGE.
47.5 kDa
E.coli
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Gene Symbol
IL-6
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Sheep IL-6 protein (orb1216257)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
