Cart summary

You have no items in your shopping cart.

SMAD1 Rabbit Polyclonal Antibody

SKU: orb574009

Description

Rabbit polyclonal antibody to SMAD1

Research Area

Cell Biology, Epigenetics & Chromatin, Protein Biochemistry, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SMAD1
TargetSMAD1
Protein SequenceSynthetic peptide located within the following region: LAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSST
Molecular Weight52kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

BSP1, JV41, BSP-1, JV4-1, MADH1, MADR1

Similar Products

  • SMAD1 Rabbit Polyclonal Antibody [orb500665]

    IF,  IHC-Fr,  IHC-P,  WB

    Gallus

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • Smad1 (phospho Ser465) rabbit pAb Antibody [orb764332]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Phospho-Smad1 (Ser463) Rabbit Polyclonal Antibody [orb158426]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-Smad1 (Ser206) Rabbit Polyclonal Antibody [orb6976]

    IF,  IHC-Fr,  IHC-P,  WB

    Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • Smad1/5/9 rabbit pAb Antibody [orb766331]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SMAD1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

SMAD1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

SMAD1 Rabbit Polyclonal Antibody

Lanes: Lane 1: 5 ug of transfected 293T lysate (SMAD1), Lane 1: 5 ug of transfected 293T lysate (SMAD2), Lane 1: 5 ug of transfected 293T lysate (SMAD3), Lane 1: 5 ug of transfected 293T lysate (SMAD4), Lane 1: 5 ug of transfected 293T lysate (SMAD5), Lane 1: 5 ug of transfected 293T lysate (SMAD6), Lane 1: 5 ug of transfected 293T lysate (SMAD7), Lane 1: 5 ug of transfected 293T lysate (SMAD8), Lane 1: 5 ug of transfected 293T lysate (GFP), Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit IgG HRP Conjugated, Secondary Antibody dilution: 1:10000, Gene Name: SMAD1.

SMAD1 Rabbit Polyclonal Antibody

WB Suggested Anti-SMAD1 Antibody Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005891

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SMAD1 Rabbit Polyclonal Antibody (orb574009)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry