Cart summary

You have no items in your shopping cart.

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

SKU: orb1981259

Description

This synthetic peptide, with the sequence STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, is derived from the angiotensin-converting enzyme 2 (ACE2) protein. It serves as a research tool for investigating ACE2's biochemical interactions and functions in both in vitro binding assays and cellular studies related to cardiovascular and pulmonary research.

Research Area

Metabolism Research

Images & Validation

Key Properties

TargetAngiotensin-converting Enzyme (ACE)
Molecular Weight3649.88

Storage & Handling

Storage-20°C
Expiration Date12 months from date of receipt.
DisclaimerFor research use only
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN (orb1981259)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet