TAZ Rabbit Polyclonal Antibody

SKU: orb331226

Description

Rabbit polyclonal antibody to TAZ

Research Area

Cardiovascular Research

Images & Validation

−

Item 1 of 2

Tested Applications	WB
Reactivity	Human, Mouse
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of TAZ
Target	TAZ
Protein Sequence	Synthetic peptide located within the following region: PNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQ
Molecular Weight	28kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti BTHS antibody, anti CMD3A antibody, anti EFE antibody, anti EFE2 antibody, anti FLJ27390 antibody, anti G4.5 antibody, anti LVNCX antibody, anti Taz1 antibody, anti XAP-2 antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Lanes: Lane 1: 20 ug mouse cardiac mitochondria lysate, Lane 2: 20 ug mouse cardiac mitochondria lysate, Lane 3: 20 ug mouse cardiac mitochondria lysate, Lane 4: 20 ug mouse cardiac mitochondria lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit-HRP, Secondary Antibody dilution: 1:2500, Gene Name: TAZ An.

WB Suggested Anti-TAZ Antibody, Titration: 1.0 ug/ml, Positive Control: Placenta.

Quick Database Links

Gene Symbol

TAZ

UniProt

Q16635

RefSeq (Protein):NP_851828

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_851828

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols