Cart summary

You have no items in your shopping cart.

TNFRSF1A Rabbit Polyclonal Antibody

SKU: orb592651

Description

Rabbit polyclonal antibody to TNFRSF1A

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Signal Transduction

Images & Validation

Tested ApplicationsIF, WB
ReactivityHuman
Predicted ReactivityGuinea pig, Mouse

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TNFRSF1A
TargetTNFRSF1A
Protein SequenceSynthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI
Molecular Weight50 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

FPF, p55, p60, TBP1, TNF-R, TNFAR, TNFR1, p55-R, CD120a, TNFR55, TNFR60, TNF-R-I, TNF-R55

Similar Products

  • TNFR1 Rabbit Polyclonal Antibody [orb100329]

    FC,  WB

    Bovine, Canine, Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
  • TNF-R1 rabbit pAb Antibody [orb770279]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • TRADD rabbit pAb Antibody [orb766508]

    ELISA,  IF,  IHC,  WB

    Human, Monkey, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • TRADD Rabbit Polyclonal Antibody [orb11504]

    IF,  IHC-Fr,  IHC-P,  WB

    Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl
  • TNF-R1 Antibody (APC) [orb151861]

    ICC,  IF,  IHC,  IP,  WB

    Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    APC

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

TNFRSF1A Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein is processed to ~48 kDa, a smaller isoform of 24 kDa also contains the peptide sequence, and the protein may also be glycosylated.

TNFRSF1A Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.

TNFRSF1A Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.

TNFRSF1A Rabbit Polyclonal Antibody

Positive control (+): THP-1 (N30), Negative control (-): SH-SY5Y (N19), Antibody concentration: 1 ug/ml.

TNFRSF1A Rabbit Polyclonal Antibody

Immunofluorescent TNFRSF1A detection in human lymphocytes (green fluorescence). Nuclei were stained with DAPI (blue fluorescence), Working dilution 5-10 ug/ml.

TNFRSF1A Rabbit Polyclonal Antibody

WB Suggested Anti-TNFRSF1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: DU145 cell lysate. TNFRSF1A is supported by BioGPS gene expression data to be expressed in DU145.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001056

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IF
Immunofluorescence
View Protocol

TNFRSF1A Rabbit Polyclonal Antibody (orb592651)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry