Cart summary

You have no items in your shopping cart.

TP53 Rabbit Polyclonal Antibody

SKU: orb573633

Description

Rabbit polyclonal antibody to p53

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Molecular Biology

Images & Validation

Tested ApplicationsChIP, ELISA, WB
ReactivityHuman
Predicted ReactivityHuman

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TP53
TargetTP53
Protein SequenceSynthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
Molecular Weight44 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

P53, BCC7, LFS1, BMFS5, TRP53

Similar Products

  • P53 (FL-393) Rabbit Polyclonal Antibody [orb2664]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine, Sheep

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • P53 (Acetyl K382) Rabbit Polyclonal Antibody [orb11497]

    FC,  IF,  IHC-Fr,  IHC-P

    Canine

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-P53 (Ser33) Rabbit Polyclonal Antibody [orb6596]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Equine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • 53BP1/TP53BP1 Rabbit Polyclonal Antibody [orb1145798]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • TP53 Rabbit Polyclonal Antibody [orb573617]

    ChIP,  IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

TP53 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. TP53 is expressed as several different isoforms (> 10) ranging in size from 24 kDa to ~50 kDa in a cell type specific manner. This immunogen for this antibody is present in several isoforms. 1-3 ug/ml is recommended for this antibody.

TP53 Rabbit Polyclonal Antibody

DU145 cells were lysed in IP lysis buffer (20mM HEPES, 1% Triton X-100, 150mM NaCl, 1mMEDTA, 1mM EGTA, 100mM NaF, 10mM Na4P2O7, 1mM Na3VO4, 0.2mM PMSF). Amount of protein per well: 30 ug, Primary antibody conditions: 1:2000 in 5% milk/TBST buffer, overnight at 4°C.Secondary antibody conditions: 1:5000 in 5% milk/TBST buffer, 1 hour at room temperature. TP53 is strongly supported by BioGPS gene expression data to be expressed in Human DU145 cells.

TP53 Rabbit Polyclonal Antibody

Sample type: HeLa cells Antibody titration: 1 to 1000, Gel: 4-15% gradient, Secondary: Goat anti-rabbit HRP, Secondary dilution: 1 to 5000. TP53 is supported by BioGPS gene expression data to be expressed in HeLa.

TP53 Rabbit Polyclonal Antibody

U20S (p53+) cells were treated with 0.5 uM Doxorubicin for 14 hrs to induce DNA damage and hence activate p53. In parallel, PLKO cells (U2OS cells with stable shRNA-mediated knockdown of p53) were treated similarly and were used as negative control. Thedata for p21 promoter were normalised to actin (control for non-specific binding of DNA to the antibodies).

TP53 Rabbit Polyclonal Antibody

WB Suggested Anti-TP53 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T. TP53 is strongly supported by BioGPS gene expression data to be expressed in HEK293T.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000537

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
ELISA
Enzyme-linked Immunosorbent Assay (EIA)
View Protocol
ChIP
Chromatin Immunoprecipitation
View Protocol

TP53 Rabbit Polyclonal Antibody (orb573633)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry