You have no items in your shopping cart.
[Tyr0]-pTH-Related Protein (1-34) (human, rat)
SKU: orb2694672
Description
Images & Validation
−![[Tyr0]-pTH-Related Protein (1-34) (human, rat)](/images/quality_badge_proteins.png)
Key Properties
−| Molecular Weight | 4180.79 |
|---|---|
| Protein Sequence | YAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA |
| Purity | ≥95% |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
[Tyr0]-pTH-Related Protein (1-34) (human, rat) (orb2694672)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review