Cart summary

You have no items in your shopping cart.

WNT5A Rabbit Polyclonal Antibody

SKU: orb574059

Description

Rabbit polyclonal antibody to WNT5A

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human WNT5A
TargetWNT5A
Protein SequenceSynthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT
Molecular Weight42 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

hWNT5A

Similar Products

  • WNT5A Rabbit Polyclonal Antibody [orb13762]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • WNT5A Antibody (Center) [orb1930406]

    FC,  IHC-P,  WB

    Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl
  • WNT5A B Rabbit Polyclonal Antibody [orb395771]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • Wnt5a Rabbit Polyclonal Antibody [orb182395]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Wnt5a Antibody [orb414035]

    IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

WNT5A Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present is at 32 kDa. The protein is also processed to 35 kDa, and may also be glycosylated and/or lipidated.

WNT5A Rabbit Polyclonal Antibody

Human Brain

WNT5A Rabbit Polyclonal Antibody

Human Colon

WNT5A Rabbit Polyclonal Antibody

Human Placenta

WNT5A Rabbit Polyclonal Antibody

Rabbit Anti-WNT5A Antibody, Catalog Number: orb574059, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Membrane, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WNT5A Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WNT5A Rabbit Polyclonal Antibody

WB Suggested Anti-WNT5A Antibody Titration: 1 ug/ml, Positive Control: Hela cell lysate, WNT5A is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003383

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

WNT5A Rabbit Polyclonal Antibody (orb574059)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry