Cart summary

You have no items in your shopping cart.

WT1 Rabbit Polyclonal Antibody

SKU: orb329588

Description

Rabbit polyclonal antibody to WT1

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityCanine, Mouse, Porcine, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human WT1
TargetWT1
Protein SequenceSynthetic peptide located within the following region: DFAPPGASAYGSLGGPAPPPAPPPPPPPPPHSFIKQEPSWGGAEPHEEQC
Molecular Weight47kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Anti-2310001G03Rik antibody, anti-PAR 4 antibody, anti-PAR-4 antibody, anti-Pawr antibody, anti-PAWR_HUMAN antibody, anti-PRKC Apoptosis WT1 Regulator antibody, anti-PRKC apoptosis WT1 regulator protein antibody, anti-Prostate apoptosis response 4 protein antibody, anti-Prostate apoptosis response protein 4 antibody, anti-prostate apoptosis response protein PAR-4 antibody, anti-Transcriptional repressor Par-4-like protein PAWR antibody, anti-Transcriptional repressor PAR4 antibody, anti-WT1 Interacting Protein antibody

Similar Products

  • WT1 Rabbit Polyclonal Antibody [orb1621]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Porcine, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PAR-4 rabbit pAb Antibody [orb766023]

    ELISA,  IF,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • WT1 Rabbit Polyclonal Antibody [orb329950]

    IHC,  WB

    Bovine, Canine, Equine, Porcine, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • PAR4 rabbit pAb Antibody [orb766022]

    ELISA,  IF,  IHC,  WB

    Bovine, Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • WTAP rabbit pAb Antibody [orb766582]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

WT1 Rabbit Polyclonal Antibody

Sample Type: Esophagus Tumor lysates, Antibody Dilution: 1.0 ug/mL.

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

WT1 Rabbit Polyclonal Antibody (orb329588)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry