You have no items in your shopping cart.
Featured
Description
Research Area
Stem Cell & Developmental Biology; Musculoskeletal & Connective Tissue Research
Images & Validation
−| Tested Applications | FA, WB |
|---|---|
| Application Notes |
Key Properties
−| Expression System | HEK293 Cells |
|---|---|
| Biological Origin | Human |
| Tag | No tag |
| Expression Region | 293-408 aa |
| Purification | Mixed-mode chromatography |
| MW | 13 kDa |
| Purity | >95% |
| Protein Sequence | SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
Storage & Handling
−| Storage | 4°C for short-term and -70°/80°C long-term |
|---|---|
| Form/Appearance | Liquid (Sterile-filtered) |
| Buffer/Preservatives | 20mM histidine pH 5.5, 0.2M NaCl, 0.6M arginine |
| Expiration Date | 6 months from date of receipt. |
| Dry Ice Shipping | Please note: This product requires shipment on dry ice. A dry ice surcharge will apply. |
| Disclaimer | For research use only |
Alternative Names
−Bone Morphogenetic Protein 4, BMP4, BMP-4, BMP2B, BMP-2B, ZYME, DVR4
Similar Products
−Goat Bone Morphogenetic Protein 4 (BMP4) ELISA Kit [orb779807]
Goat
31.25-2000 pg/mL
11.9 pg/mL
48 T, 96 TPig Bone Morphogenetic Protein 4 (BMP4) ELISA Kit [orb779808]
Porcine
0.16-10 ng/mL
0.055 ng/mL
48 T, 96 THuman Bone Morphogenetic Protein 4 (BMP4) ELISA Kit [orb781343]
Human
31.25-2000 pg/mL
12.2 pg/mL
48 T, 96 TRabbit Bone Morphogenetic Protein 4 (BMP4) ELISA Kit [orb776780]
Rabbit
15.63-1000 pg/mL
6.1 pg/mL
48 T, 96 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
WB
Western Blot (IB, immunoblot)













