Cathepsin D Antibody

SKU: orb180468

Featured

Description

Goat polyclonal antibody to Cathepsin D. Cathepsin D is a lysosomal aspartic protease of the pepsin family. Acid protease active in intracellular protein breakdown. It is composed of a dimer of disulphide-linked heavy and light chains, both produced from a single protein precursor. It is involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.

Images & Validation

−

Item 1 of 11

Tested Applications	IEM, IF, IHC-Fr, IHC-P, WB
Dilution Range	WB:1:250-1:1,000, IF:1:50-1:200, IHC-P:1:200-1:1,000, IHC-F:1:200-1:1,000, IEM:1:50-1:200
Reactivity	Canine, Human, Monkey, Mouse, Rat
Application Notes	The antibody solution should be gently mixed before use.

Key Properties

−

Host	Goat
Clonality	Polyclonal
Isotype	IgG
Immunogen	Antigen: Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. Antigen Sequence: DQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
Target	Cathepsin D
Purification	Epitope affinity purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/Appearance	Polyclonal antibody supplied as a 200 or 500 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

ceroid-lipofuscinosis, CLN10; CPSD, CTSD, lysosomal aspartyl protease, lysosomal aspartyl peptidase, neuronal 10 antibody.

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

IF – Cathepsin D Antibody at 1/100 dilution in RAW264.7 cells; cells were fixed with PFA and permeabilized with 0.05% saponin.

Cathepsin D Antibody at 1/500 dilution; endogenous CTSD (50 µg per lane); rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution.

Immunogold labeling using melanocytes and Cathepsin D Antibody.

IHC of mouse spleen using Cathepsin D Antibody and FFPE tissue after heat-induced antigen retrieval. Cathepsin D Antibody at 1:500/DAB detection.

IF – Cathepsin D Antibody at 1/100 dilution in NHI/3T3 cells; cells were fixed with methanol and permeabilized with 0.1% saponin.

Immunoperoxidase of polyclonal antibody to CTSD (1/200) on paraformaldehyde-fixed paraffin-embedded mouse lung.

Cathepsin D Antibody at 1/500 dilution; endogenous CTSD (100 µg per lane) and transfected 293FT cell lysate (at 30 µg per lane); rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilutio.

IHC of mouse brain using Cathepsin D Antibody and FFPE tissue after heat-induced antigen retrieval. Cathepsin D Antibody at 1:500/DAB detection.

IHC of mouse stomach using Cathepsin D Antibody and FFPE tissue after heat-induced antigen retrieval. Cathepsin D Antibody at 1:500/DAB detection.

IHC of mouse eye using Cathepsin D Antibody and FFPE tissue after heat-induced antigen retrieval. Cathepsin D Antibody at 1:500/DAB detection.

IHC of mouse lung using Cathepsin D Antibody and FFPE tissue after heat-induced antigen retrieval. Cathepsin D Antibody at 1:500/DAB detection.