Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CCT5 Rabbit Polyclonal Antibody

SKU: orb582502

Description

CCT5 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CCT5. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human CCT5. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CCT5
TargetCCT5
Protein SequenceSynthetic peptide located within the following region: DCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE
Molecular Weight60kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CCTE, HEL-S-69, PNAS-102, CCT-epsilon, TCP-1-epsilon

Similar Products

  • TCP1 epsilon/CCT5 Rabbit Polyclonal Antibody [orb371662]

    FC,  ICC,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • CCT5 Rabbit Polyclonal Antibody [orb582501]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • CCT5 Rabbit Polyclonal Antibody [orb625536]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat, Zebrafish

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • TCP-1 ε rabbit pAb Antibody [orb768153]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CCT5 Antibody [orb672773]

    ELISA,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

CCT5 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

CCT5 Rabbit Polyclonal Antibody

WB Suggested Anti-CCT5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: 293T cell lysate. CCT5 is supported by BioGPS gene expression data to be expressed in HEK293T.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_036205

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

CCT5 Rabbit Polyclonal Antibody (orb582502)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry