Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CD38 Recombinant Protein

SKU: orb1088589

Description

CD38 Recombinant Protein

Research Area

Immunology & Inflammation

Images & Validation

Key Properties

Expression SystemE.coli
TagHis-tag
PurificationTransferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
MW~36kDa
Protein SequenceVPRWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNIT EEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGE FNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLNGSRSKIFDKNSTF GSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPD KFLQCVKNPEDSSCTSEI

Storage & Handling

StorageStore at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Buffer/PreservativesPBS, 4M Urea, pH 7.4
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Recombinant Human CD38 Protein, C-His [orb2966793]

    ELISA,  SDS-PAGE,  WB

    >95% as determined by SDS-PAGE.

    33.15 kDa

    1 mg, 50 μg, 100 μg
  • Recombinant Cynomolgus CD38 Protein [orb2994840]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 57 KDa. Observed: 65-95 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Recombinant Mouse CD38 Protein [orb2994075]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 56.9 KDa. Observed: 70-90 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Recombinant Rat CD38 Protein [orb2994079]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 30.8 KDa. Observed: 35-50 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Recombinant Cynomolgus CD38 Protein [orb2994080]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 30.9 KDa. Observed: 38-50 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UniProt Details

No UniProt data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

500 μg
$ 990.00
1 mg
$ 1,550.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry