Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CDK4 Rabbit Polyclonal Antibody

SKU: orb573611

Description

Rabbit polyclonal antibody to CDK4

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsIHC-P, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetCDK4
Protein SequenceSynthetic peptide located within the following region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Molecular Weight34kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CMM3, PSK-J3

Similar Products

  • CDK4 Rabbit Polyclonal Antibody [orb10358]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • Cdk4 Polyclonal Antibody [orb1411572]

    IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Cdk4 Rabbit Polyclonal Antibody [orb308830]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Sertad1 Rabbit Polyclonal Antibody [orb100366]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Human, Porcine, Rabbit, Rat

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • CDKN2A Rabbit Polyclonal Antibody [orb629591]

    ELISA,  FC,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

CDK4 Rabbit Polyclonal Antibody

CDK4 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb573611 with 1:200 dilution. Western blot was performed using orb573611 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: CDK4 IP with orb573611 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.

CDK4 Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

CDK4 Rabbit Polyclonal Antibody

Lanes: 1. 30 ug human HCT116 cell lysate, 2. 30 ug genotoxic treated human HCT116 cell lysate, 3. 30 ug genotoxic treated human HCT116 cell lysate, Primary Antibody dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: CDK4.

CDK4 Rabbit Polyclonal Antibody

Lanes: Lane 1: 30 ug untreated human HCT116 cell lysate, Lane 2-3: 30 ug genotoxic agent treated human HCT116 cell lysate, Primary Antibody dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: CDK4, CDK4 is supported by BioGPS gene expression data to be expressed in HCT116.

CDK4 Rabbit Polyclonal Antibody

Rabbit Anti-CDK4 antibody, Catalog Number: orb573611, Paraffin Embedded Tissue: Human Heart cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

CDK4 Rabbit Polyclonal Antibody

WB Suggested Anti-CDK4 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000066

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

CDK4 Rabbit Polyclonal Antibody (orb573611)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry