Clec1b Rabbit Polyclonal Antibody

SKU: orb580002

Description

Rabbit polyclonal antibody to Clec1b

Research Area

Epigenetics

Images & Validation

−

Item 1 of 3

Tested Applications	WB
Reactivity	Human, Mouse
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Target	Clec1b
Protein Sequence	Synthetic peptide located within the following region: MQDEDGYITLNIKPRKQALSSAEPASSWWRVMALVLLISSMGLVVGLVAL
Molecular Weight	26 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Clec, Clec-, Clec2, Clec-2, 1810061I13Rik

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

25 ug of the indicated Mouse tissue extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. This peptide sequence matches human CLEC1B 100% and mouse Clec1b 93% amino acid identity. The protein may be phosphorylated and/or glycosylated.

Rabbit Anti-Clec1b antibody, Formalin Fixed Paraffin Embedded Tissue: Human Fetal Liver, Primary antibody Concentration: 1:50, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-Clec1b Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Pancreas.

Quick Database Links

Gene Symbol

Clec1b

UniProt

Q9JL99

RefSeq (Protein):NP_064369

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_064369

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols