Copeptin Active Peptide

SKU: orb1974385

Description

This product is Copeptin Active Peptide. Its protein sequence is SDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY. Targets Vasopressin-neurophysin 2-copeptin. Purified using HPLC.

Research Area

Hormone Research

Images & Validation

−

Key Properties

−

Target	Vasopressin-neurophysin 2-copeptin
Molecular Weight	3.95 kDa
Protein Sequence	SDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY
Purification	HPLC

Storage & Handling

−

Storage	Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.
Form/Appearance	Lyophilized
Disclaimer	For research use only

Alternative Names

−

Vasopressin; Antidiuretic Hormone; Arginine Vasopressin; ADH; Arginine vasopressin neurophysin II; ARVP; AVP; AVP NPII; AVRP; Vasopressin neurophysin 2 copeptin precursor; Vasopressin neurophysin II copeptin; VP.

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

Vasopressin-neurophysin 2-copeptin

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols