EEF1A2 Rabbit Polyclonal Antibody

SKU: orb580330

Description

Rabbit polyclonal antibody to EEF1A2

Research Area

Cardiovascular Research, Stem Cell & Developmental Biology

Images & Validation

−

Item 1 of 6

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human EEF1A2
Target	EEF1A2
Protein Sequence	Synthetic peptide located within the following region: VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP
Molecular Weight	50 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

HS1, STN, EF1A, STNL, DEE33, MRD38, EEF1AL, EIEE33, EF-1-alpha-2

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by methylation, acteylation, phosphorylation and/or lipidation.

Sample Tissue: Human Jurkat, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): Human Lung (LU), Antibody concentration: 1 ug/ml.

WB Suggested Anti-EEF1A2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human brain.

WB Suggested Anti-EEF1A2 antibody Titration: 1 ug/ml, Sample Type: Human HepG2.

Quick Database Links

Gene Symbol

EEF1A2

UniProt

Q05639

RefSeq (Protein):NP_001949

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_001949

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols