FAH Rabbit Polyclonal Antibody

SKU: orb578162

Description

Rabbit polyclonal antibody to FAH

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

−

Item 1 of 6

Tested Applications	IHC, WB
Reactivity	Human, Mouse
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human FAH
Target	FAH
Protein Sequence	Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG
Molecular Weight	46kDa
Purification	Protein A purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	1.0 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

FAH antibody - C-terminal region (orb578162) validated by WB using Jurkat cell lysate at 2.5 ug/ml.

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

Immunohistochemistry with human liver, mouse KO tissue.

Rabbit Anti-FAH Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Sample Type: Human Liver and Mouse FAH KO liver, Primary Dilution: 1:400.

Quick Database Links

Gene Symbol

FAH

UniProt

P16930

RefSeq (Protein):NP_000128

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_000128

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols