You have no items in your shopping cart.
Description
Research Area
Stem Cell & Developmental Biology
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FCRLA |
| Target | FCRLA |
| Protein Sequence | Synthetic peptide located within the following region: PTLNPAPQKSAAPGTAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYH |
| Molecular Weight | 41 |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti FCRL antibody, anti FCRLM1 antibody, anti FCRLX antibody, anti FCRLb antibody, anti FCRLc1 antibody, anti FCRLc2 antibody, anti FCRLd antibody, anti FCRLe antibody, anti FREB antibody, anti MGC4595 antibody, anti RP11-474I16.5 antibody, anti FCRX antibody, anti FCRL1 antibody
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.


