Fibronectin-Binding Protein

SKU: orb2694661

Description

Fibronectin-binding proteins (FnBPs) are a class of conserved components that are ubiquitous on the surface of bacteria, and in many gram-positive bacteria, they can recognize matrix molecules that adhere to host cells and induce the production of inflammatory cytokines.

Research Area

Musculoskeletal & Connective Tissue Research

Images & Validation

−

Key Properties

−

Target	others
MW	4309.66
Purity	≥95%
Formula	C₁₉₀H₂₈₃N₄₉O₆₆
Protein Sequence	FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

others

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols