You have no items in your shopping cart.
Featured
Description
Research Area
Epigenetics, GPCR, Neuroscience, Signaling Pathways
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Salmo salar (Atlantic salmon) |
| Tag | N-terminal 6xHis-B2M-tagged |
| Expression Region | 1-75aa |
| Protein Length | Partial |
| MW | 22.5 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Vertebrate ancient opsin
Similar Products
−Fish Salmo salar Vertebrate ancient opsin protein [orb54688]
Greater than 90% as determined by SDS-PAGE.
24.5 kDa
in vitro E.coli expression system
100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Choi, Ji Yong et al. Effects of recombinant vertebrate ancient long opsin on reproduction in goldfish, Carassius auratus: profiling green-wavelength light Fish Physiol Biochem, 44, 1027-1036 (2018)

