FOXA1 Rabbit Polyclonal Antibody

SKU: orb583752

Description

Rabbit polyclonal antibody to FOXA1

Research Area

Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

−

Item 1 of 6

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Mouse, Porcine, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human FOXA1
Target	FOXA1
Protein Sequence	Synthetic peptide located within the following region: MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTM
Molecular Weight	49 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

HNF3A, TCF3A

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

FOXA1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb583752 with 1:200 dilution. Western blot was performed using orb583752 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: FOXA1 IP with orb583752 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. FOXA1 is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-FOXA1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. FOXA1 is supported by BioGPS gene expression data to be expressed in HepG2.

WB Suggested Anti-FOXA1 antibody Titration: 1 ug/ml, Sample Type: Human heart.

WB Suggested Anti-FOXA1 antibody Titration: 1 ug/ml, Sample Type: Human liver.

Quick Database Links

Gene Symbol

FOXA1

UniProt

P55317

RefSeq (Protein):NP_004487

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_004487

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols