You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Mouse, Porcine, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FOXA1 |
| Target | FOXA1 |
| Protein Sequence | Synthetic peptide located within the following region: MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTM |
| Molecular Weight | 49 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−FOXA1 Rabbit Polyclonal Antibody [orb574302]
IHC, WB
Bovine, Canine, Guinea pig, Rat, Yeast, Zebrafish
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μlHNF-3α/β/γ (Acetyl Lys264/253/211) rabbit pAb Antibody [orb763976]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlHNF-3α/β/γ rabbit pAb Antibody [orb766929]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlFOXA1 Rabbit Polyclonal Antibody [orb627101]
ELISA, IHC, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

FOXA1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb583752 with 1:200 dilution. Western blot was performed using orb583752 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: FOXA1 IP with orb583752 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. FOXA1 is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-FOXA1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. FOXA1 is supported by BioGPS gene expression data to be expressed in HepG2.

WB Suggested Anti-FOXA1 antibody Titration: 1 ug/ml, Sample Type: Human heart.

WB Suggested Anti-FOXA1 antibody Titration: 1 ug/ml, Sample Type: Human liver.
Documents Download
Request a Document
FOXA1 Rabbit Polyclonal Antibody (orb583752)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review













