The Chicken CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APVGSDPPTSCCFTYISRQLPFSFVADYYETNSQCPHAGVVFITRKGREVCANPENDWVQDYMNKMELN) (Gene ID: 395551).