You have no items in your shopping cart.
GNL3L Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IF, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GNL3L |
| Target | GNL3L |
| Protein Sequence | Synthetic peptide located within the following region: QQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEAT |
| Molecular Weight | 66 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−GNL3L rabbit pAb Antibody [orb765317]
ELISA, IF, IHC, WB
Feline, Human, Mouse, Rat
Polyclonal
Unconjugated
100 μlGNL3L Rabbit Polyclonal Antibody [orb157230]
IF, IHC-Fr, IHC-P
Bovine, Canine, Equine, Human, Porcine, Rabbit
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl, 200 μlGNL3L Rabbit Polyclonal Antibody [orb584119]
IHC, WB
Bovine, Canine, Mouse, Porcine, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The isoforms of 66 kDa and 57 kDa are identified in a subset of these samples.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide is contained within a 66 kDa isoform as well as a 57 kDa isoform. Protein may be sumoylated.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. GNL3L is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Sample Type: HeLa, Primary Antibody dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody dilution: 2 ug/ml, Gene Name: GNL3L.

WB Suggested Anti-GNL3L Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Lung.
Documents Download
Request a Document
Protocol Information
GNL3L Rabbit Polyclonal Antibody (orb584120)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review














