You have no items in your shopping cart.
Description
Research Area
Images & Validation
−
| Tested Applications | IHC |
|---|---|
| Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep |
| Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence CSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS |
| Target | GNRH1 |
| Protein Sequence | Synthetic peptide located within the following region: CSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS |
| Molecular Weight | 10 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−GNRH1 Rabbit Polyclonal Antibody [orb412364]
IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Request a Document
Filter by Applications
Filter by Species
MA Karadağ, A Gram, S Schäfer-Somi, S Aslan, D Kaya Expression of GnRH, Kisspeptin and Their Specific Receptors in the Ovary and Uterus in Deslorelin Treated Late-Prepubertal Bitches preprints.org, (2024)
Applications
Reactivity
GNRH1 Antibody (orb585773)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review









