Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

HMOX1 Rabbit Polyclonal Antibody

SKU: orb579414

Description

HMOX1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of HMOX1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N-terminal region of Human HMOX1. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Goat, Guinea pig, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Goat, Guinea pig, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human HMOX1
TargetHMOX1
Protein SequenceSynthetic peptide located within the following region: ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM
Molecular Weight33kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HO-1, HSP32, HMOX1D, bK286B10

Similar Products

  • Heme Oxygenase 1 Rabbit Polyclonal Antibody [orb5455]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Guinea pig, Mouse, Porcine, Rabbit, Sheep

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • HMOX1 Rabbit Polyclonal Antibody [orb627747]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • HO-1 Rabbit Polyclonal Antibody [orb500607]

    IF,  IHC-Fr,  IHC-P

    Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Heme Oxygenase 1/HMOX1 Rabbit Polyclonal Antibody [orb215966]

    IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • HO-1 Antibody (APC) [orb151359]

    ICC,  IF,  IHC,  WB

    Canine, Human, Mouse, Rat

    Rabbit

    Polyclonal

    APC

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

HMOX1 Rabbit Polyclonal Antibody

HMOX1 antibody - N-terminal region (orb579414) validated by WB using tonsil and fibroblast at 1:1000.

HMOX1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.

HMOX1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.

HMOX1 Rabbit Polyclonal Antibody

Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.

HMOX1 Rabbit Polyclonal Antibody

Rabbit Anti-HMOX1 Antibody, Catalog Number: orb579414, Formalin Fixed Paraffin Embedded Tissue: Human Ovary Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002124

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

HMOX1 Rabbit Polyclonal Antibody (orb579414)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry