Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Hspa1a Rabbit Polyclonal Antibody

SKU: orb584869

Description

Hspa1a Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting Hspa1a. It is suitable for WB and is reactive with mouse, Porcine samples. Predicted reactivity includes Canine, Goat, Human, Rat, Yeast, Zebrafish. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Molecular Biology

Images & Validation

Tested ApplicationsWB
ReactivityMouse, Porcine
Predicted ReactivityCanine, Goat, Human, Rat, Yeast, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
TargetHspa1a
Protein SequenceSynthetic peptide located within the following region: KMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINE
Molecular Weight70kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Hsp, Hsp7, Hsp70, Hsp72, hsp68, Hsp70-3, Hsp70.3, hsp70A1

Similar Products

  • HSP70 Rabbit Polyclonal Antibody [orb157591]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    A. thaliana, Bovine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • HSP70 Rabbit Polyclonal Antibody [orb10848]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Gallus, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-HSP70 (Tyr611) Rabbit Polyclonal Antibody [orb157590]

    FC,  IF,  IHC-Fr,  IHC-P

    Canine, Guinea pig, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Hsp70/HSPA1A/HSPA1B Rabbit Polyclonal Antibody [orb315146]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • HSP70 Antibody (Biotin) [orb151241]

    ELISA,  FC,  ICC,  IF,  IHC,  IP,  WB

    Bovine, Canine, Fish, Guinea pig, Hamster, Human, Mammal, Monkey, Mouse, Other, Plant, Porcine, Rat, Sheep

    Rabbit

    Polyclonal

    Biotin

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Hspa1a Rabbit Polyclonal Antibody

Lanes: Lane 1: 10 ug mouse cortex brain lysate, Lane 2: 25 ug mouse cortex brain lysate, Lane 3: 40 ug mouse cortex brain lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:2000, Gene Name: Hspa1a.

Hspa1a Rabbit Polyclonal Antibody

WB Suggested Anti-Hspa1a Antibody, Positive Control: Lane 1: 80 ug pig serum, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody dilution: 1:1000.

Hspa1a Rabbit Polyclonal Antibody

WB Suggested Anti-Hspa1a Antibody, Positive Control: Lane 1: 80 ug pig serum, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody dilution: 1:1000.

Hspa1a Rabbit Polyclonal Antibody

WB Suggested Anti-Hspa1a Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Heart.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_034609

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Hspa1a Rabbit Polyclonal Antibody (orb584869)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry