Cart summary

You have no items in your shopping cart.

HSPA8 Rabbit Polyclonal Antibody

SKU: orb330554

Description

Rabbit polyclonal antibody to HSPA8

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse, Rat
Predicted ReactivityBovine, Goat, Porcine, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HSPA8
TargetHSPA8
Protein SequenceSynthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL
Molecular Weight71kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti HSC54 antibody, anti HSC70 antibody, anti HSC71 antibody, anti HSP71 antibody, anti HSP73 antibody, anti HSPA10 antibody, anti LAP1 antibody, anti MGC131511 antibody, anti MGC29929 antibody, anti NIP71 antibody

Similar Products

  • Hsc70/HSPA8 Rabbit Polyclonal Antibody [orb315149]

    FC,  ICC,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • HSPA8 Rabbit Polyclonal Antibody [orb330555]

    IHC,  WB

    Equine, Goat, Mouse, Yeast, Zebrafish

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Hsc70 Rabbit Polyclonal Antibody [orb5486]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • HSC70 Rabbit pAb Antibody [orb763845]

    IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • HSC 70 rabbit pAb Antibody [orb765444]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

HSPA8 Rabbit Polyclonal Antibody

Sample Type: Mouse Brain Slices, Red: primary, Blue: DAPI, Primary, dilution: 1:400, Secondary Antibody: Anti-Rabbit IgG Alexa 594, Secondary, dilution: 1:400.

HSPA8 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

HSPA8 Rabbit Polyclonal Antibody

Sample Type: 293T, Antibody dilution: 1.0 ug/ml.

HSPA8 Rabbit Polyclonal Antibody

Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

HSPA8 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 0.5 ug/ml.

HSPA8 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

HSPA8 Rabbit Polyclonal Antibody

Sample Type: Human 293T cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%.

HSPA8 Rabbit Polyclonal Antibody

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. HSPA8 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

HSPA8 Rabbit Polyclonal Antibody

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. HSPA8 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

HSPA8 Rabbit Polyclonal Antibody

HSPA8 antibody - N-terminal region (orb330554) validated by WB using Rat Brain lysate at 1:1000.

HSPA8 Rabbit Polyclonal Antibody

Rabbit Anti-HSPA8 Antibody, Catalog Number: orb330554, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Nuclear in pinealocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

HSPA8 Rabbit Polyclonal Antibody

WB Suggested Anti-HSPA8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006588

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

HSPA8 Rabbit Polyclonal Antibody (orb330554)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry