HSPA8 Rabbit Polyclonal Antibody

SKU: orb330555

Description

HSPA8 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of HSPA8. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human HSPA8. This antibody reacts with Human, Rat samples and is predicted to react with Equine, Goat, Mouse, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

−

Item 1 of 5

Tested Applications	IHC, WB
Reactivity	Human, Rat
Predicted Reactivity	Equine, Goat, Mouse, Yeast, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human HSPA8
Target	HSPA8
Protein Sequence	Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE
Molecular Weight	71kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti HSC54 antibody, anti HSC70 antibody, anti HSC71 antibody, anti HSP71 antibody, anti HSP73 antibody, anti HSPA10 antibody, anti LAP1 antibody, anti MGC131511 antibody, anti MGC29929 antibody, anti NIP71 antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

HSPA8

UniProt

P11142

RefSeq (Protein):NP_006588

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_006588

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry