You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml. |
| Tag | Tag-Free |
| Expression Region | 23-92aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 7.8 kDa |
| Purity | > 96% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−RecombinantMIP-1β/CCL4,Human [orb1494680]
> 95% as analyzed by SDS-PAGE and HPLC.
10-19 kDa, observed by reducing SDS-PAGE.
CHO
1 mg, 5 μg, 25 μgRecombinantMIP-1β/CCL4,Human [orb1494792]
> 95% as analyzed by SDS-PAGE and HPLC.
7.6 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
5 μg, 1 mg, 25 μgRecombinantMIP-1α/CCL3,Human [orb1494793]
> 95% as analyzed by SDS-PAGE and HPLC.
7.8 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
1 mg, 10 μg, 50 μgRecombinant Murine Macrophage Inflammatory Protein-1 gamma/ CCL9/10 (rMuCCL9/10) [orb1494921]
>95% by SDS-PAGE and HPLC analyses.
Approximately 11.5 kDa, a single non-glycosylated polypeptide chain containing 101 amino acids.
Escherichia coli.
5 μg, 20 μg, 1 mgRecombinant Human C-C motif chemokine 3 protein(CCL3) (Active) [orb1650799]
>96% as determined by SDS-PAGE and HPLC.
7.8 kDa
1 mg, 500 μg, 250 μg, 100 μg, 20 μg, 5 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

