You have no items in your shopping cart.
Human CCL3 protein (Active)
Description
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml. |
| Tag | Tag-Free |
| Molecular Weight | 7.8 kDa |
| Expression Region | 23-92aa |
| Protein Length | Partial |
| Protein Sequence | ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
| Purity | > 96% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Murine Macrophage Inflammatory Protein-1 gamma/ CCL9/10 (rMuCCL9/10) [orb1494921]
>95% by SDS-PAGE and HPLC analyses.
Approximately 11.5 kDa, a single non-glycosylated polypeptide chain containing 101 amino acids.
Escherichia coli.
1 mg, 20 μg, 5 μgRecombinantMIP-1β/CCL4,Human [orb1494792]
> 95% as analyzed by SDS-PAGE and HPLC.
7.6 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
25 μg, 5 μg, 1 mgRecombinantMIP-1α/CCL3,Human [orb1494793]
> 95% as analyzed by SDS-PAGE and HPLC.
7.8 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
50 μg, 10 μg, 1 mgRecombinantMIP-1β/CCL4,Human [orb1494680]
> 95% as analyzed by SDS-PAGE and HPLC.
10-19 kDa, observed by reducing SDS-PAGE.
CHO
25 μg, 5 μg, 1 mgRecombinant Human C-C motif chemokine 3 protein(CCL3) (Active) [orb1650799]
500 μg, 5 μg, 20 μg, 100 μg, 1 mg, 250 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human CCL3 protein (Active) (orb359068)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review