You have no items in your shopping cart.
Featured
Active
Description
Research Area
Immunology & Inflammation; Cell Biology
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Measured by its binding ability in a functional ELISA. Immobilized SIRPA at 2 μg/ml can bind human CD47, the EC50 of human CD47 protein is 65.91-82.42 ng/ml. ②Human SIRPA protein His/Myc tag captured on COOH chip can bind Human CD47 protein Fc tag with an affinity constant of 19.1 nM as detected by LSPR Assay. |
| Tag | C-terminal hFc1-tagged |
| Expression Region | 19-139aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 41.5 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Antigenic surface determinant protein OA3 (Integrin-associated protein) (IAP) (Protein MER6) (CD47)
Similar Products
−Recombinant Human CD47/MER6 Protein, C-His [orb2968053]
ELISA, SDS-PAGE, WB
>95% as determined by SDS-PAGE.
16.68 kDa
1 mg, 50 μg, 100 μgHuman Integrin Associated Protein (IAP) ELISA Kit [orb777249]
Human
0.32-20 ng/mL
0.111 ng/mL
48 T, 96 THuman Integrin Associated Protein (IAP) ELISA Kit [orb1948686]
Human
0.16-10ng/mL
0.1 ng/mL
48 T, 96 THuman CD47 Protein, mFc-His Tag [orb689369]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 60 kDa after removal of the signal peptide.
Mammalian
10 μg, 100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide


















