You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized EPHA3 at 2 μg/ml can bind human EFNA5, the EC50 of human EFNA5 protein is 0.8674-1.119 ng/ml. |
| Tag | C-terminal hFc1-tagged |
| Expression Region | 21-203aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 50.1 kDa |
| Purity | Greater than 93% as determined by SDS-PAGE. |
| Protein Sequence | QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Human EFNA5 Protein [orb2994465]
Unconjugated
Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 48.3 KDa. Observed: 55-60 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human EFNA5 Protein, N-His [orb2968369]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
23.46 kDa
100 μg, 1 mg, 50 μgHuman EFNA5 protein [orb391647]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
10 μg, 50 μg, 500 μgRecombinant Human EFNA5 Protein, N-His [orb2835738]
>90% as determined by SDS-PAGE.
23.48 kDa
20 μg, 50 μg, 100 μgHuman EFNA5 Protein [orb425251]
Greater than 95.0% as determined by SDS-PAGE.
Sf9, Baculovirus cells
5 μg, 20 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.



