You have no items in your shopping cart.
Featured
Active
Description
Research Area
Cancer Biology
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Measured by its binding ability in a functional ELISA. Immobilized GH1 at 1 μg/ml can bind human GHR, the EC50 of human GHR protein is 24.96-33.39 ng/ml. ②Human GH1 protein his/myc tag captured on COOH chip can bind Human GHR protein Fc tag with an affinity constant of 6.1 nM as detected by LSPR Assay. |
| Tag | C-terminal hFc1-tagged |
| Expression Region | 27-264aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 58.8 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Somatotropin receptor (Serum-binding protein)
Similar Products
−Human GHR protein [orb10083]
Greater than 90% as determined by SDS-PAGE.
44.4 kDa
E.coli
100 μg, 1 mg, 20 μgHuman GHR Protein, hFc Tag [orb1173826]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 53.8 kDa after removal of the signal peptide. The apparent molecular mass of GHR-hFc is approximately 55-100 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide















