Human IL1RA protein

SKU: orb594814

This product can be custom made

Featured

Active

Description

This Human IL1RA protein spans the amino acid sequence from region 26-177aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Images & Validation

−

Item 1 of 1

Application Notes	Full Length of Mature Protein

Key Properties

−

Source	E.coli
Biological Origin	Homo sapiens (Human)
Biological Activity	The ED50 as determined by its ability to inhibit IL-1 beta induced NF-kB signaling in 293-IL1 Res cells is 13.2 ng/mL.
Tag	Tag-Free
Expression Region	26-177aa
Protein Length	Full Length of Mature Protein
Endotoxins	Less than 1.0 EU/μg as determined by LAL method.
MW	17.26 kDa
Purity	Greater than 95% as determined by SDS-PAGE.
Protein Sequence	RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 50 mM Tris-HCl, 0.2 M NaCl, pH 7.5
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Interleukin-1 Receptor Antagonist Protein; IL-1RN; IL-1ra; IRAP; ICIL-1RA; IL1 Inhibitor; Anakinra; IL1RN; IL1F3; IL1RA

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P18510

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols