You have no items in your shopping cart.
Description
Research Area
Immunology & Inflammation
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E. Coli |
|---|---|
| Purity | Greater than 90% as determined by SDS PAGE. |
| Protein Sequence | MKHHHHHHASQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP |
Storage & Handling
−| Storage | Stability: For long term, store lyophilized AIF1 at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.The lyophilized protein remains stable for 24 months when stored at -20°C |
|---|---|
| Form/Appearance | Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | Filtered and lyophilized from 0.5mg/ml in 20mM Tris buffer and 50mM NaCl pH-7.5. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−AIF-1, Allograft inflammatory factor 1, Em:AF129756.17, G1, IBA1, Ionized calcium-binding adapter molecule 1, IRT-1, Protein G1, AIF1.
Similar Products
−- Item 1 of 6
- Item 1 of 6
- Item 1 of 1
Human Interferon Gamma Inducible Protein 30 (IFI30) ELISA Kit [orb777067]
Human
0.16-10 ng/mL
0.056 ng/mL
96 T, 48 T - Item 1 of 1
Human Tryptophanyl tRNA Synthetase (WARS) ELISA Kit [orb779034]
Human
1.57-100 ng/mL
0.58 ng/mL
96 T, 48 T - Item 1 of 1
Human Interferon Gamma Induced Protein 10kDa (IP-10/CXCL10) ELISA Kit [orb1807392]
Human
7.82-500pg/mL
3.1 pg/mL
96 T, 48 T
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Human Interferon gamma Protein (orb80254)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days