Human interleukin 6 (IL-6) 29-212 aa

SKU: orb1729595

Description

Interleukin-6 (IL-6) is a 22-28 kDa phosphorylated and variably glycosylated cytokine that plays important roles in the acute phase reaction, inflammation, hematopoiesis and bone metabolism. Mature human IL-6 is 183 amino acids (aa) in length and shares 39% aa sequence identity with mouse IL-6. Aberrant IL-6 activity contributes to chronic inflammation in obesity, insulin resistance, inflammatory bowel disease, arthritis, sepsis, and atherosclerosis.

Images & Validation

−

Tested Applications	SDS-PAGE
Application Notes	For research use only

Key Properties

−

Source	E.coli
Species/Host	E. coli
Expression System	Intercellular
Biological Origin	Recombinant protein expressed as His tage protein in E.coli
Reactivity	Human, Mouse
Tag	Histidine
Molecular Weight	~22 kDa
Protein Sequence	VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity	≥85%
Endotoxins	Not tested
Conjugation	Unconjugated

Storage & Handling

−

Storage	After reconstitution, store at -20°C; Avoid repeated freeze thaw
Form/Appearance	Lyophilized
Buffer/Preservatives	No preservative
Concentration	1mg/mL
Hazard Information	For Research use only
Disclaimer	For research use only

Alternative Names

−

B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

UniProt

P05231

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

SDS-PAGE

Sodium Dodecyl Sulphate PolyAcrylamide Gel Electrophoresis

View Protocol

Find More Protocols