You have no items in your shopping cart.
Human RANKL protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Loaded Recombinant Human OPG-Fc on Pro A Biosensor, can bind Human RANKL with an affinity constant of 1.83 pM as determined in BLI assay. ②Loaded Human RANK-His on HIS1K Biosensor, can bind Human RANK L with an affinity constant of <1 pM as determined in BLI assay. |
| Tag | Tag-Free |
| Molecular Weight | 22.4 kDa |
| Expression Region | 140-317aa |
| Protein Length | Partial |
| Protein Sequence | IRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human TNFSF11 Protein, hFc Tag [orb757436]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 48.4 kDa after removal of the signal peptide.The apparent molecular mass of hFc-TNFSF11 is approximately 55-70 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μgRecombinant Human CD254/RANKL/TNFSF11 Protein, N-Fc [orb2966855]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
48.32 kDa
1 mg, 50 μg, 100 μgRecombinant Human CD254/RANKL/TNFSF11 Protein, N-His [orb3154534]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
26.92 kDa
50 μg, 100 μg, 1 mgRecombinant Human CD254/RANKL/TNFSF11 Protein, N-His [orb3154535]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
23.66 kDa
50 μg, 100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human RANKL protein (orb594839)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






