You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B at 2 μg/ml can bind TNFRSF13C, the EC50 is 9.943-15.72 ng/ml. ②Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF13C at 2 μg/ml can bind Biotinylated human TNFSF13B, the EC50 is 0.2699-0.5613 ng/ml. |
| Tag | C-terminal hFc1-Flag-tagged |
| Expression Region | 7-71aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 36.4 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Human BAFF-R Protein, mFc Tag [orb689403]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 33.6 kDa after removal of the signal peptide.The apparent molecular mass of BAFF-R-mFc is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μgRecombinant Human TNFRSF13C Protein [orb2993094]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 7.4 KDa. Observed: 15-25 KDa, reducing conditions
500 μg, 1 mg, 10 μg, 50 μgRecombinant Mouse BAFFR Protein [orb2993875]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 33.8 KDa. Observed: 40-55 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human BAFFR Protein [orb2993844]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 33.4 KDa. Observed: 38-58 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgCD268/TNFRSF13C Mouse Monoclonal Antibody [orb2959217]
ELISA, NeA
Human, Mouse
Mouse
Monoclonal
Unconjugated
1 mg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.










