You have no items in your shopping cart.
Human VEGFA protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human umbilical vein endothelial cells(HUVEC) is between 1.0-8.0 ng/ml. |
| Tag | Tag-Free |
| Molecular Weight | 19.3 kDa |
| Expression Region | 27-191aa |
| Protein Length | Partial of Isoform 4 |
| Protein Sequence | M+APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human Vascular Endothelial Growth Factor A (VEGFA) EasyStep ELISA Kit [orb1950027]
Human
78.2-5000 pg/mL
31 pg/mL
48 T, 96 THuman VEGFA Protein, His Tag [orb757432]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 14.8 kDa after removal of the signal peptide.
Mammalian
100 μg, 10 μg, 50 μgHuman VEGF 165 protein [orb178366]
SDS-PAGE
Unconjugated
> 85% as determined by SDS-PAGE
0.5 mg, 1 mg, 0.1 mgRecombinant human VEGF-165 protein, His (HEK293) [orb1516684]
>95% as determined by SDS-PAGE
24 kDa
100 μg, 500 μg, 20 μgVEGFA Rabbit Polyclonal Antibody [orb1289717]
IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl, 30 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human VEGFA protein (orb419318)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








