Cart summary

You have no items in your shopping cart.

Human VEGFA protein

SKU: orb419318
FeaturedFeatured Product
ActiveBiologically Active

Description

This Human VEGFA protein spans the amino acid sequence from region 27-191aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Research Area

Cancer Biology

Images & Validation

Application Notes
Tag Info: NO-taggedExpression Region: 27-191aaSequence Info: Full Length

Key Properties

SourceYeast
Biological OriginHomo sapiens (Human)
Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human umbilical vein endothelial cells(HUVEC) is between 1.0-8.0 ng/ml.
TagTag-Free
Molecular Weight19.3 kDa
Expression Region27-191aa
Protein LengthPartial of Isoform 4
Protein SequenceM+APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity> 97% as determined by SDS-PAGE and HPLC.
EndotoxinsLess than 1.0 EU/μg as determined by LAL method.

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20
DisclaimerFor research use only

Alternative Names

VEGF-A, VPF

Similar Products

  • Human VEGFA Protein, His Tag [orb757432]

    Unconjugated

    The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

    The protein has a predicted molecular mass of 14.8 kDa after removal of the signal peptide.

    Mammalian

    50 μg, 100 μg, 10 μg
  • Human Vascular Endothelial Growth Factor A (VEGFA) EasyStep ELISA Kit [orb1950027]

    Human

    78.2-5000 pg/mL

    31 pg/mL

    48 T, 96 T
  • Human VEGF 165 protein [orb178366]

    SDS-PAGE

    Unconjugated

    > 85% as determined by SDS-PAGE

    0.5 mg, 1 mg, 0.1 mg
  • VEGFA Antibody [orb1289717]

    IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 50 μl, 100 μl, 200 μl
  • Recombinant human VEGF-165 protein, His (HEK293) [orb1516684]

    >95% as determined by SDS-PAGE

    24 kDa

    100 μg, 500 μg, 20 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Human VEGFA protein

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Human VEGFA protein (orb419318)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
$ 380.00
100 μg
$ 1,540.00
500 μg
$ 3,430.00
DispatchUsually dispatched within 1-2 weeks
Bulk Enquiry