You have no items in your shopping cart.
IL1A Protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Tag | C-terminal 6xHis-Myc-tagged |
| Molecular Weight | 21.9 kDa |
| Expression Region | 113-271aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQYLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEIPKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA |
| Purity | Greater than 85% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human IL1 alpha protein (Active) [orb358965]
> 97% as determined by SDS-PAGE and HPLC.
18.0 kDa
E.Coli
10 μg, 100 μg, 500 μgMonkey IL1 alpha protein (Active) [orb358997]
> 97% as determined by SDS-PAGE and HPLC.
18.1 kDa
E.Coli
100 μg, 10 μg, 500 μgMouse IL1 alpha protein (Active) [orb359005]
> 97% as determined by SDS-PAGE and HPLC.
17.9 kDa
E.Coli
10 μg, 100 μg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
IL1A Protein (orb1477919)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





