Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

IL1RAPL1 Rabbit Polyclonal Antibody

SKU: orb327227

Description

IL1RAPL1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of IL1RAPL1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C-terminal region of Human IRPL1. This antibody reacts with Human samples and is predicted to react with Human. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityHuman

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human IRPL1
TargetIL1RAPL1
Protein SequenceSynthetic peptide located within the following region: YEYDVPPTGTLPLTSIGNQHTYCNIPMTLINGQRPQTKSSREQNPDEAHT
Molecular Weight76kDa
PurificationAffinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti IL1RAPL1 antibody, anti OPHN4 antibody, anti antibody

Similar Products

  • IL1RAPL1 Rabbit Polyclonal Antibody [orb10901]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Guinea pig, Human, Porcine, Rabbit

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • IL1RAPL1 Rabbit Polyclonal Antibody [orb628009]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • IL1RAPL1 Rabbit Polyclonal Antibody [orb666992]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl, 30 μl
  • IL1RAPL1 Rabbit Polyclonal Antibody (HRP) [orb469949]

    IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Guinea pig, Human, Porcine, Rabbit

    Mouse, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl
  • IL1RAPL1 Rabbit Polyclonal Antibody (FITC) [orb15833]

    FC,  IF

    Bovine, Canine, Equine, Gallus, Guinea pig, Human, Porcine, Rabbit

    Mouse, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

IL1RAPL1 Rabbit Polyclonal Antibody

Sample Type: Fetal Kidney lysates, Antibody Dilution: 1.0 ug/mL.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

IL1RAPL1 Rabbit Polyclonal Antibody (orb327227)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry