KMT5B Rabbit Polyclonal Antibody

SKU: orb325667

Description

Rabbit polyclonal antibody to Suv420h1

Research Area

Epigenetics & Chromatin

Images & Validation

−

Item 1 of 4

Tested Applications	ChIP, WB
Reactivity	Mouse
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Target	KMT5B
Protein Sequence	Synthetic peptide located within the following region: FINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFC
Molecular Weight	32 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti AA117471 antibody, anti C630029K18Rik antibody, anti KMT5B antibody, anti MGC18702 antibody, anti Suv4-20h1 antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 2 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL. Multiple isoforms of this protein are expressed in the samples shown as indicated.

Chromatin Immunoprecipitation (ChIP) Using Suv420h1 antibody - C-terminal region (orb325667) and HCT116 Cells.

Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

WB Suggested Anti-Suv420h1 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Thymus.

Quick Database Links

Gene Symbol

KMT5B

UniProt

Q3U8K7

RefSeq (Protein):NP_001161356

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_001161356

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

ChIP

Chromatin Immunoprecipitation

View Protocol

Find More Protocols