C2orf33 Rabbit Polyclonal Antibody

SKU: orb325479

Description

Rabbit polyclonal antibody to MFF

Research Area

Cell Biology

Images & Validation

−

Item 1 of 5

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf33
Target	MFF
Protein Sequence	Synthetic peptide located within the following region: VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW
Molecular Weight	38kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti DKFZp666J168 antibody, anti GL004 antibody, anti MGC110913 antibody, anti C2orf33 antibody

MFF Rabbit Polyclonal Antibody [orb101576]

Applications:	ELISA, IF, IHC-Fr, IHC-P, WB
Predicted Reactivity:	Bovine, Equine, Gallus, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Sizes Available: 50 μl, 100 μl, 200 μl

Item 1 of 1
MFF Rabbit Polyclonal Antibody [orb411978]
Applications:
WB
Reactivity:
Human, Mouse, Rat
Species/Host:
Rabbit
Clonality:
Polyclonal
Conjugation:
Unconjugated
Sizes Available: 50 μl, 100 μl, 200 μl, 30 μl

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.

Positive control (+): MCF7 (N10), Negative control (-): A549 (N03), Antibody concentration: 1 ug/mL.

WB Suggested Anti-C2orf33 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Muscle.

Quick Database Links

Gene Symbol

MFF

UniProt

Q9GZY8

RefSeq (Protein):NP_064579

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_064579

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols