Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Monkey REG3a ELISA Kit

SKU: orb566441

Description

Monkey REG3a ELISA Kit

Research Area

Immunology & Inflammation

Images & Validation

Application Notes
Healthy monkey serum:diluted 1:2–1:5; measured concentrations ranged from 227 pg/mL to 793 pg/mL. Healthy monkey plasma:diluted 1:2; measured concentrations ranged from 189 pg/mL to 801 pg/mL. For reference only.

Key Properties

ReactivityMonkey
Sample TypesSerum,Plasma,Cell Culture Supernatant,Cell or tissue lysate,Other liquid samples
Assay TypeSandwich
Assay Time4 hours
Range15.625-1000pg/ml
Sensitivity9.375pg/ml
Protein SequenceStandard protein is Recombinant Monkey REG3A (Green Monkey, expression region 27–175: EEPQKELPSPRIRCPKGSKAYGSHCYALFLSPKSWMDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSISNSYSYVWIGLHDPTQGTEPNGDGWEWSSSDVMNYFAWERNPSTISNPGHCAGLSRSTAFLRWKDYNCDVKLPYVCKFTD)

Procedure & Performance

Assay Principle
The kit is based on a sandwich enzyme immunoassay principle. The microtiter plate is pre-coated with a capture antibody specific to the target analyte. Standards or samples are added to the wells, followed by a biotin-conjugated detection antibody specific for the analyte. Avidin conjugated to horseradish peroxidase (HRP) is then added and incubated. After addition of the TMB substrate, color develops only in wells containing the analyte bound to the detection antibody and HRP–avidin complex. The reaction is stopped with an acidic solution, and absorbance is measured at 450 nm ± 10 nm. The analyte concentration in the samples is determined by comparison with a standard curve.
Kit Components
1. ELISA Microplate
2. Standards
3. Detection Antibody
4. HRP-Streptavidin Conjugate
5. TMB Substrate
6. Dilution buffers
7. Stop Solution
8. Wash Buffer
9. Plate Sealers
10. Manual
Reagent Preparation
1. Wash Buffer: Prepare the 1X Wash Buffer using distilled water according to the manual.
2. Standard: Perform gradient dilution according to the instructions in the manual.
3. Other Concentrated Reagents: Dilute the concentrated reagents using the Dilution Buffers provided in the kit to 1 X working solutions as instructed in the manual. Always use a clean pipette tip for each different solution.
Assay Procedure
After the kit equilibrates to room temperature, add standards or samples to each well and incubate.
Discard liquid, add wash buffer to each well, wash the plate twice, and blot dry on clean absorbent paper.
Add biotinylated antibody working solution to each well and incubate.
Discard liquid, add wash buffer to each well, wash the plate three times, and blot dry on clean absorbent paper.
Add streptavidin-HRP working solution to each well and incubate.
Discard liquid, add wash buffer to each well, wash the plate five times, and blot dry on clean absorbent paper.
Add TMB substrate solution to each well and incubate in the dark.
Add stop solution to each well, mix thoroughly, and immediately read OD at 450 nm.
Materials Required
1. Microplate readers
2. Centrifuge
3. Incubator
4. Automated plate washer
5. Single-channel or multi-channel high-precision pipettes
6. Disposable pipette tips
7. Sterile tubes
8. Eppendorf tubes
9. Absorbent paper
10. Loading slots
Precision
Intra-assay Precision (Precision within an assay): CV% < 8%
Intra-assay precision was evaluated by testing multiple replicates of samples within the same plate.

Inter-assay Precision (precision between assays): CV% < 10%
Inter-assay precision was evaluated by testing samples across different plates.
Calculation of Results
1. Average the duplicate readings for each Standard, Control, and Sample, and subtract the mean optical density of the zero Standard.
2. Construct a standard curve by plotting the target concentration on the y-axis against absorbance on the x-axis and draw a curve through the data points.
3. Determine the sample concentration by substituting the OD450 value into the standard curve. For diluted samples, multiply the calculated value by the corresponding dilution factor.
Curve Fitting Softwares
1. Curve Expert
2. Thermo SkanIt RE
3. SciDAVis
4. LabPlot
5. ……

Storage & Handling

Storage2 - 8 °C for 12 months
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Reg3a|Lithostathine 3|PAP2|REG3A|hepatocarcinoma-intestine-pancreas|HIPpancreatitis-associated protein|Human proislet peptide|pancreatic beta cell growth factor|Pancreatitis-associated protein 1|PAP homologous protein|PAP1FLJ18565|PAPPAP-H|PBCGF|prolifeRation-inducing protein 34|prolifeRation-inducing protein 42|Reg III-alpha|REG3|REG-3-alpha|regeneRating islet-derived 3 alpha|RegeneRating islet-derived protein III-alpha|REG-III

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UniProt Details

No UniProt data available

Protocol Information

Available Sizes

Select a size below

48 T
$ 410.00
96 T
$ 560.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry