You have no items in your shopping cart.
Description
Research Area
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Mouse |
| Target | IL-10 |
| Protein Length | 170.0 |
| MW | 18.8 kDa |
| Purity | 98% |
| Protein Sequence | SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (170) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Recombinant Mouse IL-22 Protein [orb2995243]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (Regularly tested)
Predicted: 16.7 KDa. Observed: 15 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Mouse IL-22 Protein [orb2994339]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 43.8 KDa. Observed: 50-65 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgMouse IL10 protein (Active) [orb359015]
> 97% as determined by SDS-PAGE and HPLC.
18.7 kDa
E.Coli
100 μg, 500 μg, 10 μgMouse Il10 protein [orb594838]
Greater than 95% as determined by SDS-PAGE.
18.9 kDa
E.coli
1 mg, 500 μg, 50 μg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Documents Download
Request a Document
Protocol Information
Mouse IL-10 protein (orb1216249)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

