Mouse IL17E Protein

SKU: orb80456

This product can be custom made

Description

Recombinant of Mouse IL17E protein

Research Area

Immunology & Inflammation

Images & Validation

−

Application Notes	Cytokines And Growth Factors

Key Properties

−

Source	Escherichia Coli
Biological Activity	The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488ng/ml.
Purity	Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Protein Sequence	VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA

Storage & Handling

−

Storage	Stability: Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
Form/Appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Buffer/Preservatives	IL17E was lyophilized from a concentrated (1mg/ml) solution containing no additives.
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

IL-25, IL-17E, IL17E, IL25, Interleukin-25.

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols