Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Mouse TNF alpha protein

SKU: orb1216254

Description

The Mouse TNF alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse TNF alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse TNF alpha yeast-derived recombinant protein can be purchased in multiple sizes. Mouse TNF alpha Specifications: (Molecular Weight: 17.3 kDa) (Amino Acid Sequence: LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)) (Gene ID: 21926).

Research Area

Immunology & Inflammation

Images & Validation

Key Properties

SourceYeast
Biological OriginMouse
TargetTNF alpha
Protein Length156.0
MW17.3 kDa
Purity98%
Protein SequenceLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

TNFSF2

Similar Products

  • Mouse Tumor Necrosis Factor Alpha Induced Protein 6 (TNFaIP6) ELISA Kit [orb781809]

    Mouse

    78.13-5000 pg/mL

    29 pg/mL

    96 T, 48 T
  • Recombinant Human TNF RII Protein [orb2994890]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 46.44 KDa. Observed: 60 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Mouse Tnf protein [orb594857]

    Greater than 95% as determined by SDS-PAGE.

    16.4 kDa

    E.coli

    1 mg, 500 μg, 10 μg, 50 μg
  • RAGE/AGER Rabbit Polyclonal Antibody [orb1098124]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • LEF1 Rabbit Polyclonal Antibody [orb763052]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Mouse TNF alpha protein (orb1216254)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 300.00
25 μg
$ 540.00
100 μg
$ 1,340.00
500 μg
$ 4,260.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry