Mouse TNF alpha protein

SKU: orb1216254

Description

The Mouse TNF alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse TNF alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse TNF alpha yeast-derived recombinant protein can be purchased in multiple sizes. Mouse TNF alpha Specifications: (Molecular Weight: 17.3 kDa) (Amino Acid Sequence: LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)) (Gene ID: 21926).

Images & Validation

−

Key Properties

−

Source	Yeast
Biological Origin	Mouse
Target	TNF alpha
Molecular Weight	17.3 kDa
Protein Length	156.0
Protein Sequence	LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)
Purity	98%

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

TNFSF2

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

TNF alpha

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols