Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Mouse TNF alpha protein

SKU: orb1216254

Description

The Mouse TNF alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse TNF alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse TNF alpha yeast-derived recombinant protein can be purchased in multiple sizes. Mouse TNF alpha Specifications: (Molecular Weight: 17.3 kDa) (Amino Acid Sequence: LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)) (Gene ID: 21926).

Research Area

Immunology & Inflammation

Images & Validation

Key Properties

SourceYeast
Biological OriginMouse
TargetTNF alpha
Protein Length156.0
MW17.3 kDa
Purity98%
Protein SequenceLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

TNFSF2

Similar Products

  • Mouse Tumor Necrosis Factor Alpha Induced Protein 6 (TNFaIP6) ELISA Kit [orb781809]

    Mouse

    78.13-5000 pg/mL

    29 pg/mL

    48 T, 96 T
  • Mouse Tnf protein [orb594857]

    Greater than 95% as determined by SDS-PAGE.

    16.4 kDa

    E.coli

    50 μg, 10 μg, 1 mg, 500 μg
  • Recombinant Human TNF RII Protein [orb2994890]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 46.44 KDa. Observed: 60 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • RAGE/AGER Rabbit Polyclonal Antibody [orb1098124]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • TNF alpha Mouse Monoclonal Antibody [orb323199]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Mouse

    Monoclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Mouse TNF alpha protein (orb1216254)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 300.00
25 μg
$ 540.00
100 μg
$ 1,340.00
500 μg
$ 4,260.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry